PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G072200.1
Common NamePHAVU_011G072200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 201aa    MW: 21816.7 Da    PI: 4.781
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G072200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.93.1e-42351341100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeA  r+rdPvyG++g i +lq+q+++l+
  Phvul.011G072200.1  35 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVTSMVYEASSRIRDPVYGCAGAICQLQKQVNELQ 125
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la+ ++e
  Phvul.011G072200.1 126 AQLAKSQAE 134
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.17234135IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4235132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MESSDTYTPA SSAPLSHSPT SSSSSPPPPT VVMTPCAACK ILRRRCAEKC VLAPYFPPTE  60
PAKFTIAHRV FGASNIIKFL QELPESQRAD AVTSMVYEAS SRIRDPVYGC AGAICQLQKQ  120
VNELQAQLAK SQAELVTMQL QQANLVALIC MEMAQSPEES PQQSVDDFIS TPPHSGGYQS  180
GMNFFEENTS PNSLWEPLWT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971750.0BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132174.11e-147hypothetical protein PHAVU_011G072200g
SwissprotQ9SK082e-76LBD11_ARATH; LOB domain-containing protein 11
TrEMBLV7AH571e-147V7AH57_PHAVU; Uncharacterized protein
STRINGGLYMA11G15810.11e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.19e-77LOB domain-containing protein 11